General Information

  • ID:  hor006516
  • Uniprot ID:  O93448
  • Protein name:  Urotensin-1
  • Gene name:  NA
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NDDPPISIDLTFHLLRNMIEMARIESQKEQAELNRKYLDEV
  • Length:  41(123-163)
  • Propeptide:  MKPVPLILLLATVLLSSHIPPSVCRPRDLAMFDGHGYKSQLDEVLLKAGDNAISYLIGEKILRYLQRNPRLQAGLPPQFPFEVTPLGSRGLGHLARSLPPLEEQRAPEEGNSLEEFVELTKRNDDPPISIDLTFHLLRNMIEMARIESQKEQAELNRKYLDEVGK
  • Signal peptide:  MKPVPLILLLATVLLSSH
  • Modification:  T41 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor. The non-hormonal portion of this precursor may be a urotensin binding protein, urophysin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O93448-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006516_AF2.pdbhor006516_ESM.pdb

Physical Information

Mass: 560020 Formula: C212H343N59O69S2
Absent amino acids: CGW Common amino acids: EL
pI: 4.35 Basic residues: 6
Polar residues: 7 Hydrophobic residues: 13
Hydrophobicity: -70.49 Boman Index: -11034
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 97.56
Instability Index: 6370.73 Extinction Coefficient cystines: 1490
Absorbance 280nm: 37.25

Literature

  • PubMed ID:  10417230
  • Title:  Rainbow trout (Oncorhynchus mykiss) urotensin-I: structural differences between urotensins-I and urocortins.